PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000173636
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 373aa    MW: 41558.5 Da    PI: 8.4291
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000173636genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.26.3e-53151421128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                    lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfF++rd+ky++g r+nra++sgyWkatg+dk++l++ 
  MDP0000173636  15 LPPGFRFHPTDEELVVHYLKKKAASIPLPV-TIIAEVDLYKFDPWELPSKATFGEQEWYFFTPRDRKYPNGARPNRAATSGYWKATGTDKPILTSi 109
                    79****************************.89***************8888999**************************************998 PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    ++++vg+kk Lvfy g+ pkg kt+W+mheyrl
  MDP0000173636 110 GNHNVGVKKALVFYGGKPPKGIKTNWIMHEYRL 142
                    9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.85E-6410181IPR003441NAC domain
PROSITE profilePS5100560.98915181IPR003441NAC domain
PfamPF023659.2E-2816142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MESTDSSSGS QHPQLPPGFR FHPTDEELVV HYLKKKAASI PLPVTIIAEV DLYKFDPWEL  60
PSKATFGEQE WYFFTPRDRK YPNGARPNRA ATSGYWKATG TDKPILTSIG NHNVGVKKAL  120
VFYGGKPPKG IKTNWIMHEY RLINNTTTAK MSFSTTKPSD AANKKASLRL DDWVLCRVYK  180
KNNAQRPTMS MEGDHFLHKA EDSNSSMEEG MFLHPSIWPT QKPSPFPPPP SSKLPTTNYT  240
ALLESDYHES FFEGILSSSD HQQGFHSHHH DHDHDQFGAI STSGSKTSIP LKRQLSSPFW  300
NDVGSIGSAA ATTTSSSKRF HADLNSENNS FVSILNQMPE GTAPLYPNPA LLGPLGDGVL  360
RPQFQLPSMN WNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-731518315170Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.15790.0cell culture| fruit
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981240.0KF198124.1 Malus hupehensis NAC domain protein (NAC92) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001281058.10.0NAC transcription factor 25-like
SwissprotQ8GY421e-109NAC25_ARATH; NAC transcription factor 25
TrEMBLD9ZJA20.0D9ZJA2_MALDO; NAC domain class transcription factor
STRINGPOPTR_0011s04650.11e-145(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-103NAC domain containing protein 25